Zum Inhalt springen

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 8(PCR8)

https://www.afsbio.de/web/image/product.template/117048/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9M815 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRVTTPSEEDSNNGLPVQQPGTPNQRTRVPVSQFAPPNYQQANVNLSVGRPWSTGLFDC QADQANAVLTTIVPCVTFGQIAEVMDEGEMTCPLGTFMYLLMMPALCSHWVMGSKYREKM RRKFNLVEAPYSDCASHVLCPCCSLCQEYRELKIRNLDPSLGWNGILAQGQGQYEREAPS FAPTNQYMSK Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 8 Short name= AtPCR8 Gene Names:Name:PCR8 Ordered Locus Names:At1g52200 ORF Names:F9I5.19 Expression Region:1-190 Sequence Info:fµLl length protein

1.536,00 € 1536.0 EUR 1.536,00 €

1.536,00 €

Not Available For Sale

Diese Kombination existiert nicht.

Geschäftsbedingungen
30-Tage-Geld-zurück-Garantie
Versand: 2-3 Geschäftstage